PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK23416.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 364aa    MW: 41763.6 Da    PI: 6.7966
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK23416.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.42.3e-5671361129
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                +ppGfrFhPtdeelv++yL+kk+++k+++l +vik+vd+yk+ePwdL++  k+ + e++ewyfFs++dkky+tg+r+nratk+g+Wkatg+dk++++ ++
  PK23416.1   7 VPPGFRFHPTDEELVDYYLRKKIASKRIDL-DVIKDVDLYKIEPWDLQElcKLGSeEQNEWYFFSHKDKKYPTGTRTNRATKAGFWKATGRDKAIYA-RH 104
                69****************************.9***************954544442556**************************************.88 PP

        NAM  98 elvglkktLvfykgrapkgektdWvmheyrle 129
                +l+g++ktLvfykgrap+g+k+dW+mheyrle
  PK23416.1 105 SLIGMRKTLVFYKGRAPNGQKSDWIMHEYRLE 136
                9*****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-615156IPR003441NAC domain
PROSITE profilePS5100560.1617156IPR003441NAC domain
PfamPF023659.0E-298135IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0048759Biological Processxylem vessel member cell differentiation
GO:1901348Biological Processpositive regulation of secondary cell wall biogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MNTFSHVPPG FRFHPTDEEL VDYYLRKKIA SKRIDLDVIK DVDLYKIEPW DLQELCKLGS  60
EEQNEWYFFS HKDKKYPTGT RTNRATKAGF WKATGRDKAI YARHSLIGMR KTLVFYKGRA  120
PNGQKSDWIM HEYRLETNEN GTSQEEGWVV CRVFKKRMAT VRKAGDYDSP PCWYDDQVSF  180
MPTELESPMR SVSHHNHHHN HQAYTSSFHQ NHYPNNNCKQ ELELHQFNMP RATLVGDPFF  240
QLPQLESPKL PSTSTTTHAE DHQSCLMMMS NGSVFSNELQ AVDQLMMMTN NASNNNNNNG  300
SSTTDWRVLD KLVASQLGHH DEDQQLTTAA AAGAGAPVFH VPHQLVINNL LGGDGDDHLE  360
QRLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-51615714169Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00136DAPTransfer from AT1G12260Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015867542.11e-160PREDICTED: NAC domain-containing protein 7-like
SwissprotQ9FWX21e-141NAC7_ARATH; NAC domain-containing protein 7
TrEMBLB9T2V21e-157B9T2V2_RICCO; NAC domain-containing protein, putative
STRINGVIT_02s0154g00020.t011e-154(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF126933106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G12260.11e-138NAC 007